Protein Info for MMJJ_RS01060 in Methanococcus maripaludis JJ

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 125.9 bits, E=8.7e-41

Best Hits

Swiss-Prot: 53% identical to Y796_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0796 (MJ0796) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02003, (no description) (inferred from 74% identity to mmx:MmarC6_0369)

MetaCyc: 43% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (1/7 steps found)

Protein Sequence (234 amino acids)

>MMJJ_RS01060 ABC transporter ATP-binding protein (Methanococcus maripaludis JJ)
METIISLKNVWKIYPMGDFEVQALKNVSLDIEKGDFVAIVGASGSGKSTMMNMVGCLDIP
TKGTVILKSNDISKLSESKLSKLRGESIGFIFQQYNLIPSMTALENVMLPLQFQEVNDSE
AEKRAEAVLKLVGLSDRVNNRPSQLSGGQQQRVSIARALACKPEIILADEPTGALDSKTG
KEVIAILQKLWKKNKNTIIMITHDMNLAKAANTVVELKDGNIVNIEKNKEIVEY