Protein Info for MMJJ_RS01020 in Methanococcus maripaludis JJ
Annotation: serine protease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 99% identity to mmp:MMP0785)Predicted SEED Role
"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors
Isozymes
Compare fitness of predicted isozymes for: 3.4.21.-
Use Curated BLAST to search for 3.4.21.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (258 amino acids)
>MMJJ_RS01020 serine protease (Methanococcus maripaludis JJ) MIKNTLSNVMAATFCIELPNGKAGGMPTPAGTGFFISPEGWFVTAAHVVMDKKGYLRKDL DRAFLIKEQNAKDPKKICQYVSPGPIFPGLDIALLKVDFEKNSDKEWLDKKTEFPFIKVS TGRLEMGDEVYSFGYPLSSYGIIKSGEIGYTKLSPRVTSAIISSNFDTNMGAAGPKNYVL DKALNYGNSGGPIIATETGHAHAICSRFQPLVVPQQHIKDNNGNPLPIMIPSLYGVVSSF NNKDIIGFLMSLDIPIEE