Protein Info for MMJJ_RS00870 in Methanococcus maripaludis JJ

Annotation: F420-nonreducing hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01058: Oxidored_q6" amino acids 12 to 162 (151 residues), 121.5 bits, see alignment E=9.7e-40

Best Hits

Swiss-Prot: 78% identical to VHCG_METVO: F420-non-reducing hydrogenase vhc subunit G (vhcG) from Methanococcus voltae

KEGG orthology group: K14128, F420-non-reducing hydrogenase subunit G [EC: 1.12.99.-] (inferred from 99% identity to mmp:MMP0822)

MetaCyc: 56% identical to ferredoxin hydrogenase gamma component monomer (Methanothermobacter thermautotrophicus)

Predicted SEED Role

"CoB--CoM-reducing hydrogenase (Cys) gamma subunit" in subsystem H2:CoM-S-S-HTP oxidoreductase

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.-

Use Curated BLAST to search for 1.12.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MMJJ_RS00870 F420-nonreducing hydrogenase (Methanococcus maripaludis JJ)
MVKIATTWLACCSGCHISLVDLHEDLLKVLEQVELVHSPVLMDVKEIPDDIDVALIEGGI
RNEENLHIAQEMRKKAKIVIAFGTCAVYGGIPGMGNLYSNEALLEKAYKTTFSTKNEEGI
IPSEDVPELTSRVKPLSDVIDVDYILPGCPPKPELIAGVLTSLLEGKTPELTTKNMCEVC
PREKSKEGVSIDSIKRNYEGTPDPKKCLLEQGYLCMGIATRASCGAICPTAGVPCTGCYG
PTDKVVDQGAKMVSALASDYKIDEDRTMDPNELPKQILDKVGSFYKFTLPSALIPINNKR