Protein Info for MMJJ_RS00860 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF00037: Fer4" amino acids 2 to 25 (24 residues), 24.2 bits, see alignment (E = 1.6e-08) amino acids 32 to 47 (16 residues), 22.7 bits, see alignment (E = 4.7e-08) amino acids 63 to 82 (20 residues), 24 bits, see alignment (E = 1.8e-08) amino acids 132 to 150 (19 residues), 26.9 bits, see alignment (E = 2.2e-09) amino acids 158 to 179 (22 residues), 26.6 bits, see alignment (E = 2.8e-09) amino acids 198 to 218 (21 residues), 25.6 bits, see alignment (E = 5.8e-09) amino acids 263 to 285 (23 residues), 25.7 bits, see alignment (E = 5.2e-09) amino acids 309 to 326 (18 residues), 27.7 bits, see alignment (E = 1.2e-09) amino acids 341 to 361 (21 residues), 23.1 bits, see alignment (E = 3.4e-08) PF12800: Fer4_4" amino acids 7 to 21 (15 residues), 11 bits, see alignment (E = 0.00036) amino acids 31 to 44 (14 residues), 14.9 bits, see alignment (E = 2e-05) amino acids 66 to 81 (16 residues), 15.1 bits, see alignment (E = 1.7e-05) amino acids 94 to 106 (13 residues), 15.9 bits, see alignment (E = 9.7e-06) amino acids 133 to 148 (16 residues), 17.4 bits, see alignment (E = 3.1e-06) amino acids 201 to 215 (15 residues), 15.8 bits, see alignment (E = 1.1e-05) amino acids 309 to 322 (14 residues), 17.1 bits, see alignment (E = 4e-06) amino acids 344 to 360 (17 residues), 18 bits, see alignment (E = 1.9e-06) PF13237: Fer4_10" amino acids 30 to 80 (51 residues), 29.7 bits, see alignment 3.6e-10 amino acids 66 to 105 (40 residues), 25.4 bits, see alignment 7.5e-09 amino acids 130 to 175 (46 residues), 29.4 bits, see alignment 4.2e-10 amino acids 197 to 242 (46 residues), 34 bits, see alignment 1.6e-11 amino acids 306 to 358 (53 residues), 28.8 bits, see alignment 6.5e-10 amino acids 340 to 386 (47 residues), 26.1 bits, see alignment 4.5e-09 PF12798: Fer4_3" amino acids 32 to 46 (15 residues), 14.6 bits, see alignment (E = 3.5e-05) amino acids 69 to 82 (14 residues), 14.4 bits, see alignment (E = 4.3e-05) amino acids 94 to 105 (12 residues), 15.4 bits, see alignment (E = 2e-05) amino acids 135 to 149 (15 residues), 13.7 bits, see alignment (E = 7.2e-05) amino acids 164 to 178 (15 residues), 13.1 bits, see alignment (E = 0.00011) amino acids 310 to 324 (15 residues), 19.9 bits, see alignment (E = 7.3e-07) amino acids 347 to 360 (14 residues), 13.8 bits, see alignment (E = 6.3e-05) PF13187: Fer4_9" amino acids 32 to 82 (51 residues), 32.1 bits, see alignment 6.5e-11 amino acids 94 to 149 (56 residues), 31.6 bits, see alignment 9.8e-11 amino acids 164 to 217 (54 residues), 28.7 bits, see alignment 7.9e-10 amino acids 269 to 324 (56 residues), 28.6 bits, see alignment 8e-10 PF12838: Fer4_7" amino acids 32 to 82 (51 residues), 40.8 bits, see alignment 1.8e-13 amino acids 94 to 149 (56 residues), 38.1 bits, see alignment 1.2e-12 amino acids 163 to 216 (54 residues), 39.3 bits, see alignment 5e-13 amino acids 231 to 284 (54 residues), 30.9 bits, see alignment 2.2e-10 amino acids 310 to 360 (51 residues), 41.7 bits, see alignment 8.9e-14 PF12837: Fer4_6" amino acids 62 to 82 (21 residues), 24.5 bits, see alignment (E = 1.4e-08) amino acids 196 to 218 (23 residues), 25.9 bits, see alignment (E = 4.8e-09) amino acids 340 to 360 (21 residues), 26.1 bits, see alignment (E = 4.2e-09) PF13183: Fer4_8" amino acids 162 to 216 (55 residues), 28.9 bits, see alignment 9.9e-10

Best Hits

Swiss-Prot: 56% identical to VHUB_METVO: Polyferredoxin protein VhuB (vhuB) from Methanococcus voltae

KEGG orthology group: K05912, [EC: 1.12.-.-] (inferred from 97% identity to mmp:MMP0824)

Predicted SEED Role

"CoB--CoM-reducing hydrogenase (Cys) beta subunit" in subsystem H2:CoM-S-S-HTP oxidoreductase

Isozymes

Compare fitness of predicted isozymes for: 1.12.-.-

Use Curated BLAST to search for 1.12.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>MMJJ_RS00860 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MIKINTEDCYMCKACENSCPTEALKLNPFKVCQLCGNCVNACPNDALNLREIELNGKTIK
QIEYFPTKCDLCGECVKVCPNNLKIENDKLKGFCVGCMKCVEACPDDYVGMEGVVEPAKR
NITLPKEPIAVTEDCVGCGVCISECPVGALSIEGEKAVVDKNSCIYCSICAQTCPWNAIF
VAGKKSPKRDKNIVKFSVDSDLCIGCGDCTDKCPRDLIVLNEMVAVPPKGCPACGLCMAA
CPVDAIELVVEYGSPKPITDEGIVWDEEKCAYCGPCAIKCPNNAINVVNPKGLEMPSRKK
TEKANEFKMCIRCGACVQSCPNDALRIGKIIHDGKEYERIEFSPNLCDSCGKCIETCPYD
MLNLTGKPEKPLEGFCVMCLKCIEACDKAKKSALSLK