Protein Info for MMJJ_RS00800 in Methanococcus maripaludis JJ

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 383 (363 residues), 154.1 bits, see alignment E=2.5e-49 amino acids 265 to 431 (167 residues), 40.9 bits, see alignment E=6.2e-15

Best Hits

KEGG orthology group: None (inferred from 95% identity to mmq:MmarC5_0835)

Predicted SEED Role

"Glycerol-3-phosphate transporter" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>MMJJ_RS00800 MFS transporter (Methanococcus maripaludis JJ)
MLSKDNIGKMMKYRWVIFAVLALVYFFVYFHRVSPAVMAGDLMTTFGVGATSMGLLGSVY
FYAYALMQIPSGIMSDKFGPRRVVAVFTLVAAAGAILTGIATDFNMVILGRLLIGVGVAA
VYIPIMKMLSIWFRKNEFATQSGVMLAVGNIGALSAAAPLAYLNTSLGWQTVFMGLGVAS
VALAILSYIVIRDKPSEMGFPNIEDIEAQENGETVSAEAKPAENISIMDSIKMVLGKKSF
WPLAIWFFFYYGSLMAYQGLWAGPYFKDILGWDKATYASLLTFIGIGLILGCPVSGYLAD
KVLKSRKKTLIIGTVMYTLLWFAVWYFNGMDNPLFYKILYLLFGFFAGFFVVCYGQVKSL
FPISITGTSTSILNFFPFFGGALLQQVCGLLIASYGLNALGGYTSAGYQMAWLLLAVGMV
IATICVYFSEEKGL