Protein Info for MMJJ_RS00730 in Methanococcus maripaludis JJ

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00401: peptide-methionine (S)-S-oxide reductase
  • amino acids 5 to 151 (147 residues), 195.2 bits, E=4e-62
• PF01625: PMSR
  • amino acids 6 to 153 (148 residues), 208.2 bits, E=3.9e-66

Best Hits

Swiss-Prot: 94% identical to MSRA_METMP: Peptide methionine sulfoxide reductase MsrA (msrA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 94% identity to mmp:MMP0848)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Protein Sequence (157 amino acids)

>MMJJ_RS00730 peptide-methionine (S)-S-oxide reductase MsrA (Methanococcus maripaludis JJ)
MKNIKTIVFGMGCFWGAEEVFRKVNGVVSTEVGFMGGIIKNPTYGQVCRGKSGHIEVVKI
DYEPEIISYDELLDLFWNNHNPTTPNKQGWDVGEQYSSYIFYFDDEQKLIAEKSLEKMQE
HTDSKIVTNIKKAGNFYPAEEYHQKYFMKKNNSILNF