Protein Info for MMJJ_RS00665 in Methanococcus maripaludis JJ

Annotation: lysine 2,3-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR03820: lysine-2,3-aminomutase" amino acids 20 to 431 (412 residues), 747.1 bits, see alignment E=4.7e-229 TIGR00238: KamA family protein" amino acids 20 to 344 (325 residues), 366.5 bits, see alignment E=1.1e-113 PF13353: Fer4_12" amino acids 128 to 192 (65 residues), 28.8 bits, see alignment E=2.1e-10 PF04055: Radical_SAM" amino acids 132 to 279 (148 residues), 50.8 bits, see alignment E=3.5e-17 PF12544: LAM_C" amino acids 323 to 432 (110 residues), 135.4 bits, see alignment E=1.9e-43

Best Hits

Swiss-Prot: 99% identical to ABLA_METMP: L-lysine 2,3-aminomutase (ablA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 99% identity to mmp:MMP0861)

MetaCyc: 59% identical to lysine 2,3-aminomutase (Clostridium subterminale)
Lysine 2,3-aminomutase. [EC: 5.4.3.2]

Predicted SEED Role

"Lysine 2,3-aminomutase (EC 5.4.3.2)" in subsystem Lysine degradation (EC 5.4.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>MMJJ_RS00665 lysine 2,3-aminomutase (Methanococcus maripaludis JJ)
MNELSDESILKYTKKISENATIDNWNDYKWQLSNSIKDVDTLENFLGITFDEKEKTEIQK
AIDVFPMSITPYYASLIDTKNLDKDPIYKQSVASSKELILENFEMEDPLSEDEDSPVIGI
THRYPDRVLFYINPNCAMYCRHCTRKRKVSEKSSNPSKEEIQKAIDYIKNNDKIRDVLLS
GGDPLLLSDEFLDWILSEISSIKHVELIRIGSRVPVVLPQRITDNLVNVLKKYHPIWINT
HYNHPVEITKESKKALDKLSDSGIPLGNQTVLLAGVNDCPYVMRKLNQKLVSSRVRPYYL
YQCDLSKGISHFRTSVSKGLEIIESLIGHTTGFAVPRYVVDAPGGGGKIPVMPNYVVSWG
SDRVILRNYEGIITSYVEPSDYGGCSKNCDTCDRMCIGDFEINQTGIEKLITDVDNSISL
IPENNERVARRDD