Protein Info for MMJJ_RS00650 in Methanococcus maripaludis JJ

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 383 (365 residues), 182.4 bits, see alignment E=6.2e-58

Best Hits

KEGG orthology group: None (inferred from 97% identity to mmp:MMP0864)

Predicted SEED Role

"NapA-2 Na+/H+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>MMJJ_RS00650 cation:proton antiporter (Methanococcus maripaludis JJ)
MDISWVLFTVGVCLIFGKIGNEIMWRFGFPSVFGEILIGIIFGNLLFFGIVDSSHLTLHE
NDIFDFLSTVGIMFLLFLSGLEIDIHRLKKTENISIVAAVLGAVFPLIFGYISLSYFGYT
TKESIVGGVILTATSIGITARLLMDLKVLKTDVGAAAISASILDDFLGLILLILAVGSGS
LLGLISEITVFFIITGYLGWKLIKKYLIFAEKFHIEKTVLSFTLALMFLFSFLSESWFEV
AIEGAFMAGLILSKTSEGKSLAKEIKSIGNSFLIPLFFIYTGARLNLTAFLNHEALILAT
ILIIVGVLSKFVGWGLGAKLIGKWGLKKSIQLASASVPRAEIALINLMIAVSAGVILEEN
ISKFIAATLIFVTFSIVITPPLLKKVFE