Protein Info for MMJJ_RS00615 in Methanococcus maripaludis JJ

Annotation: nucleoside deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF14437: MafB19-deam" amino acids 3 to 131 (129 residues), 76.7 bits, see alignment E=1.6e-25 PF00383: dCMP_cyt_deam_1" amino acids 3 to 97 (95 residues), 88.1 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 55% identical to FCA1_CANAX: Cytosine deaminase (FCA1) from Candida albicans

KEGG orthology group: K01485, cytosine deaminase [EC: 3.5.4.1] (inferred from 94% identity to mmp:MMP0869)

MetaCyc: 51% identical to cytosine deaminase (Saccharomyces cerevisiae)
Cytosine deaminase. [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]

Predicted SEED Role

"Cytosine deaminase (EC 3.5.4.1)" (EC 3.5.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>MMJJ_RS00615 nucleoside deaminase (Methanococcus maripaludis JJ)
MTDFMDEAIKEANLGLKEGGIPIGAVLVYENKIIGRGHNRRVQNNSSILHAEMDALENAG
RLTSNIYKNCELYTTLSPCIMCSGAVLLYKIKKVVIGENKTFLGAEDLLMNNGVAVEVLN
DERCVKMMEEFIGNNPKLWNEDIGE