Protein Info for MMJJ_RS00570 in Methanococcus maripaludis JJ

Annotation: ribonuclease P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF01900: RNase_P_Rpp14" amino acids 14 to 108 (95 residues), 59.9 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 98% identical to RNP2_METMP: Ribonuclease P protein component 2 (rnp2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03537, ribonuclease P/MRP protein subunit POP5 [EC: 3.1.26.5] (inferred from 98% identity to mmp:MMP0878)

Predicted SEED Role

"Ribonuclease P protein component 2 (EC 3.1.26.5)" in subsystem Ribonuclease P archaeal and eukaryal (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.5

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>MMJJ_RS00570 ribonuclease P (Methanococcus maripaludis JJ)
MLKTLPPTLREKKRYVALEIIYEMELSQKDVISVVRNALLNYSGVLGCSKTNPWLIDYNH
PYGILRISREEVDTLRSSLSLMGEHKKKPINIRIIGISNSVKHIREKFLHVPHEPYYKVI
QKLKRKGPKK