Protein Info for MMJJ_RS00415 in Methanococcus maripaludis JJ

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details PF09335: VTT_dom" amino acids 36 to 150 (115 residues), 60.5 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0909)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>MMJJ_RS00415 DedA family protein (Methanococcus maripaludis JJ)
MDFYQFAEYIVLNYGYFGIFLIAFTEAVIQPILPDIFIIGASAFGLDSVTCALVASFGSL
TGGYTGYFLGKKLGTNVFLKIFKEKYFIKGKAFFEKFGVWDVAIAGFTPIPYKVFAWLAG
IFKMNLVSFGAGTLLGRIPRFLLVAYFGYSLGLLFGLHTP