Protein Info for MMJJ_RS00355 in Methanococcus maripaludis JJ

Annotation: ribonuclease P protein component 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF04032: Rpr2" amino acids 18 to 98 (81 residues), 66.1 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 98% identical to RNP4_METMP: Ribonuclease P protein component 4 (rnp4) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03540, ribonuclease P protein subunit RPR2 [EC: 3.1.26.5] (inferred from 98% identity to mmp:MMP0921)

Predicted SEED Role

"Ribonuclease P protein component 4 (EC 3.1.26.5)" in subsystem Ribonuclease P archaeal and eukaryal (EC 3.1.26.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.5

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>MMJJ_RS00355 ribonuclease P protein component 4 (Methanococcus maripaludis JJ)
MKLKKKFLEKSKKVAEERINILMNQAEKESNSGKTERSKNYVLLGKKIAMRMRMPYPKEW
KRRICKNCGSFLIYGKNARVRTKAKNYPHVVITCLDCNSITRIPIKTAKK