Protein Info for MMJJ_RS00280 in Methanococcus maripaludis JJ

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00507: shikimate dehydrogenase" amino acids 7 to 278 (272 residues), 328.8 bits, see alignment E=1.1e-102 PF08501: Shikimate_dh_N" amino acids 11 to 93 (83 residues), 107.4 bits, see alignment E=5.5e-35 PF01488: Shikimate_DH" amino acids 116 to 194 (79 residues), 33.6 bits, see alignment E=6e-12 PF18317: SDH_C" amino acids 245 to 273 (29 residues), 47 bits, see alignment (E = 2.6e-16)

Best Hits

Swiss-Prot: 96% identical to AROE_METMP: Shikimate dehydrogenase (NADP(+)) (aroE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 96% identity to mmp:MMP0936)

MetaCyc: 65% identical to shikimate dehydrogenase monomer (Methanocaldococcus jannaschii)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MMJJ_RS00280 shikimate dehydrogenase (Methanococcus maripaludis JJ)
MIDSKTKLVGLIGHPIDHSFSPIMHNAAIKDLKINYRYFAFDVSEKNLKDVVTGAKALNF
RGFNVTIPHKVNIMKYLDEIDCDAEVIGAVNTVKIENGKAIGYNTDGIGVKKALEEKTGI
LINKNILIIGSGGASRAVSFELAKDNNLTIVNRNIEKAENLSKEISKKLKKENPLNYGGL
DINIENFDIIINTTPVGMYPNTEVDPVIPLHNIKKDAVVMDLIYNPLEPVFLKEAKKYGA
KTINGIGMLVYQGAVSFEIWTGIKPDIFVMKKSIISKI