Protein Info for MMJJ_RS00270 in Methanococcus maripaludis JJ

Annotation: adenosylcobinamide-GDP ribazoletransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 1 to 246 (246 residues), 183.4 bits, see alignment E=3.1e-58 PF02654: CobS" amino acids 9 to 244 (236 residues), 143.4 bits, see alignment E=5.4e-46

Best Hits

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to mmp:MMP0938)

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MMJJ_RS00270 adenosylcobinamide-GDP ribazoletransferase (Methanococcus maripaludis JJ)
MIDELKGLVLFMTRIPVGRSKSDFEGIAKYFMFMPLVGTLISLFGVFTAYILNYLGFTSG
NIIGTAVLFTLLYIQGFHHLDGLADYGDSWMVTGNARKKLEVMKDVYMGIGGFVFVFFVE
LLSLFSFAYLFETSTFTLFLKYIIIIETCSRLGLLSCACCGIPANDGTGRFFAKKSNEYH
LLTGLIFSLGVSILLQIPKIGVLCSILAVFLGMFIAWKCNNKLGCVTGDIFGATAEISRM
VFLIVIIAFTPYFSLIG