Protein Info for MMJJ_RS00265 in Methanococcus maripaludis JJ

Annotation: TIGR02253 family HAD-type hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR02253: HAD hydrolase, TIGR02253 family" amino acids 1 to 217 (217 residues), 256.1 bits, see alignment E=6e-80 PF00702: Hydrolase" amino acids 2 to 188 (187 residues), 83.2 bits, see alignment E=5e-27 PF13419: HAD_2" amino acids 5 to 193 (189 residues), 91.8 bits, see alignment E=9.1e-30 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 109 to 188 (80 residues), 34.7 bits, see alignment E=4.5e-12 PF13242: Hydrolase_like" amino acids 148 to 201 (54 residues), 45.3 bits, see alignment E=9.9e-16

Best Hits

Swiss-Prot: 70% identical to G3PP_METJA: Glyceraldehyde 3-phosphate phosphatase (MJ1437) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to mmp:MMP0939)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>MMJJ_RS00265 TIGR02253 family HAD-type hydrolase (Methanococcus maripaludis JJ)
MIKGVLFDLDDTLYNSSSFASRARKEALRAMIDAGLNSTEEDALKILNKIIEQKGSNYGG
HFNDLVKAVNGTYDPKIITMGIITYHNVKFALLRPYSDTMNTLMDLRSIGLSLGILTDGI
TIKQWEKLIRLGIHPFFDEVITSEEYGLGKPNIEFFNYGLKKINLKPEEVVYVGDRADKD
MVPAKNVGMTTVRILQGKYSEIPDDISDYSIKNISELSKIIKTLI