Protein Info for MMJJ_RS00225 in Methanococcus maripaludis JJ

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR00070: ATP phosphoribosyltransferase" amino acids 3 to 186 (184 residues), 212.1 bits, see alignment E=6.2e-67 PF01634: HisG" amino acids 49 to 208 (160 residues), 181.6 bits, see alignment E=1e-57 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 187 to 287 (101 residues), 103.2 bits, see alignment E=7.2e-34 PF08029: HisG_C" amino acids 213 to 286 (74 residues), 82.1 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 98% identical to HIS1_METMP: ATP phosphoribosyltransferase (hisG) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 98% identity to mmp:MMP0947)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>MMJJ_RS00225 ATP phosphoribosyltransferase (Methanococcus maripaludis JJ)
MILLALPNKGRISKPVNEILEKSGLKISVHGRSLFANTVDPEIKVMFARAKDIPEFVRDG
VADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVLAAPENSDVNSIEDVKDGMKIATEF
PGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTGTTLQLNRLKEIENVVSS
TTRLVANKKSMKDPEKSAKINQVLSGIKSVMYAQSKRLIMMNAPKDKVSEITSVIPGMGG
PTVSEILSNCDMLAINAVIDENKVFETVSNLEKLGARDILVVPIERIL