Protein Info for MMJJ_RS00205 in Methanococcus maripaludis JJ

Annotation: adenosylcobinamide-phosphate synthase CbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00380: cobalamin biosynthesis protein CobD
  • amino acids 1 to 304 (304 residues), 343.6 bits, E=5.1e-107
• PF03186: CobD_Cbib
  • amino acids 7 to 283 (277 residues), 271.1 bits, E=5.2e-85

Best Hits

Swiss-Prot: 96% identical to COBD_METMP: Probable cobalamin biosynthesis protein CobD (cobD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 96% identity to mmp:MMP0951)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (4/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (6/9 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (3/6 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Protein Sequence (306 amino acids)

>MMJJ_RS00205 adenosylcobinamide-phosphate synthase CbiB (Methanococcus maripaludis JJ)
MINPIYLILADFFDRYIGEPPEKVHPVVFIGKLISFFENVFKSSNSVNKSRDLIFGFLNV
ALVLGIVFFMAYEIEQVINSISNSYIKISLYSIILSFSIGHKSLIEFSKSPIKFIVNNDL
ESAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV
NTFDAMIGYKSEKYLYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNVKSALLGYFN
EGSKTPSPNSGYTMATLANSLHMELEKIGYYKLGKGEITVEKALNSLKAVDYSVLLFLII
YMMLFM