Protein Info for MMJJ_RS00185 in Methanococcus maripaludis JJ

Annotation: succinate--CoA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 2 to 286 (285 residues), 429.4 bits, see alignment E=3.3e-133 PF02629: CoA_binding" amino acids 5 to 98 (94 residues), 95.2 bits, see alignment E=6.7e-31 PF13380: CoA_binding_2" amino acids 35 to 127 (93 residues), 23 bits, see alignment E=1.9e-08 PF13607: Succ_CoA_lig" amino acids 144 to 277 (134 residues), 42.1 bits, see alignment E=1.5e-14 PF00549: Ligase_CoA" amino acids 150 to 270 (121 residues), 89.1 bits, see alignment E=5.6e-29

Best Hits

Swiss-Prot: 73% identical to SUCD_METJA: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 99% identity to mmp:MMP0955)

MetaCyc: 53% identical to succinyl-CoA synthetase subunit alpha (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MMJJ_RS00185 succinate--CoA ligase subunit alpha (Methanococcus maripaludis JJ)
MILLDENTRAIVQGITGNQGRFHTKNMLECKTNILAGVTPGKGGQDVYGVPVYDTVLETV
EKYDANASLIFIPAPFVKDAAYEAIDAGVELVTIITEHIPIQDSMDIVAYGKKHGVNIIG
PNTPGLASPKVGKLGIIPMSILKEGNIGMVSRSGTLTYEIASQLTLSNYGQSSCVGIGGD
PITGLRYIEVLEMFENDPETDAVVMVGEIGGNAEEDAAEKMISKMKKPVISYIAGQSAPE
GKRMGHAGAIIEKGVGTAKSKMQALENAGAHVAKRISDIPLLLKEII