Protein Info for MMJJ_RS00090 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 67 to 92 (26 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details PF12801: Fer4_5" amino acids 67 to 105 (39 residues), 25.6 bits, see alignment 4.7e-10 amino acids 165 to 200 (36 residues), 31.4 bits, see alignment 7.4e-12

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0974)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MMJJ_RS00090 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MKEKKFELKSKLKKTNFFNLVKYGFFLVAIPSVFLVIFRCPYTVPFLVCDLCPVIDCPSK
NYRRLIFGALLGYVAITRVDFCGKVCPLGTLNDLFYKVKMKISKKPLKLSLELKIILDLL
KWTIFLFVIIAIINGNPRFYIPIHAGELLDSIRLSLLAGGNAYYARLILVLGAISLGVVI
PRFWCRYICPYGTTIQLTKKGIKKVKAHTCTNCGKHDSN