Protein Info for MMJJ_RS00075 in Methanococcus maripaludis JJ

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02374: ArsA_ATPase
  • amino acids 3 to 48 (46 residues), 31.4 bits, 3e-11
• PF01656: CbiA
  • amino acids 4 to 235 (232 residues), 79.9 bits, E=4e-26
• PF13614: AAA_31
  • amino acids 5 to 179 (175 residues), 40.1 bits, E=1e-13

Best Hits

Swiss-Prot: 52% identical to Y823_METJA: Uncharacterized ATP-binding protein MJ0823 (MJ0823) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07321, CO dehydrogenase maturation factor (inferred from 96% identity to mmx:MmarC6_1681)

MetaCyc: 44% identical to CooC (Rhodospirillum rubrum)
RXN-12291

Predicted SEED Role

"CO dehydrogenase accessory protein CooC (nickel insertion)" in subsystem Carbon monoxide induced hydrogenase

Protein Sequence (260 amino acids)

>MMJJ_RS00075 AAA family ATPase (Methanococcus maripaludis JJ)
MKIAITGKGGVGKTTFSGTLACILSEKYKVYAIDADPDMNLASSLGITDKITPISKMKEL
IKERTGAEQGSSFGEVFKINPKTSDLPEKLSVNYDKQGNLKIMVMGTVEKGGTGCVCPAS
VLLKALIRNLILKKDEVVILDMEAGIEHLGRKTAEAVDVMIVVSEASSKSMETVERIKKL
AEEIGIKKIVCVLNKISNETEKSFASENLNRIGLEILGCIPYDPEVSVADMKREPLVKYE
NSKAHIEIRKISEKIMNLKN