Protein Info for MMJJ_RS00040 in Methanococcus maripaludis JJ

Annotation: CO dehydrogenase/acetyl-CoA synthase complex subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02552: CO_dh
  • amino acids 5 to 169 (165 residues), 170.5 bits, E=1.4e-54
• TIGR00315: CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit
  • amino acids 9 to 169 (161 residues), 204.7 bits, E=4.3e-65

Best Hits

Swiss-Prot: 32% identical to ACDE_METBU: Acetyl-CoA decarbonylase/synthase complex subunit epsilon (cdhB) from Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)

KEGG orthology group: K00195, acetyl-CoA decarbonylase/synthase complex subunit epsilon (inferred from 96% identity to mmx:MmarC6_1674)

Predicted SEED Role

"CO dehydrogenase/acetyl-CoA synthase subunit epsilon, CO dehydrogenase subcomplex (EC 1.2.99.2)" in subsystem Carbon monoxide induced hydrogenase (EC 1.2.99.2)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2

Protein Sequence (172 amino acids)

>MMJJ_RS00040 CO dehydrogenase/acetyl-CoA synthase complex subunit epsilon (Methanococcus maripaludis JJ)
MDGDRTTPWQPTVIAGPKHGMLVTPAIAKMMLKKAKNPLFVIGPLIKDDDGLISLCKNIV
EAWNLPVVATGNIYKSLTENGIKSKRYGTIEIVNLLKDPEWKGINSEGQHDLVLFIGVTY
YLASQGLSSLKHFAPHLKTVTLCKYFHSNADASFPNMSDSEWTNYLEKMSKI