Protein Info for MMJJ_RS00025 in Methanococcus maripaludis JJ

Annotation: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00398: RrnaAD" amino acids 2 to 216 (215 residues), 202.4 bits, see alignment E=3.8e-64 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 2 to 258 (257 residues), 268.7 bits, see alignment E=2.3e-84

Best Hits

Swiss-Prot: 93% identical to RSMA_METMP: Probable ribosomal RNA small subunit methyltransferase A (rsmA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 93% identity to mmp:MMP0987)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>MMJJ_RS00025 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA (Methanococcus maripaludis JJ)
MKKSKKLGQCFLKDKNFVKKAINRAELNDKDIVLEVGLGEGALTKELAKIAKKVYVIELD
ERLKPFADEITAEFENVEIIWSDALKVDLKSIEFNKIVANLPYQISSPITFKFLEEDFET
AVLMYQYEFAKRMAGKPDTKEYSRLSVAVQYNADVEFICKVPPSAFSPKPDVNSAIVKLT
KREPKYHVKDEEFFKKVLKAMFQHRNRTVKRALIDSSHEIEIDRDNLKEILEKIENEFDF
TERVFKTPPEKIGHLSNLLYGEMLNLE