Protein Info for LRK55_RS18665 in Rhodanobacter denitrificans MT42

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF16576: HlyD_D23" amino acids 42 to 227 (186 residues), 77.9 bits, see alignment E=1.4e-25 PF13533: Biotin_lipoyl_2" amino acids 54 to 99 (46 residues), 25.4 bits, see alignment 1.9e-09 PF13437: HlyD_3" amino acids 172 to 232 (61 residues), 35 bits, see alignment E=4.2e-12

Best Hits

KEGG orthology group: None (inferred from 48% identity to app:CAP2UW1_4537)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>LRK55_RS18665 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter denitrificans MT42)
MLFPVAAVAVNNTFPVSAAQMRALGITVQRLDKPAAIRGLSYPARVILPPQQDVVISAPV
AGVVEQLLVTEHQRLTIGQPLLRLASPEFGELQLAALEAANKNRLAQQTLQREKQLFAEG
IVPQRRLLEAEAAASDGKAGLRQTSAALRLAGLDAPAVARLIGSGALQESLTLKARSAGL
VVDLQAKPGQRVAAADPLLRIADPSQLWLDIQIPAKRADAWAKDGDITVVGRPVTARPMQ
AGAVVGEGQTVSLRARISAGVDRVRPGEAVQVQVPFADRANAWSLPLAAVARQGEQAYVF
VRTAQGFDARKVNVVASAGQSVSVLGPLKSADQVAVSSVIALKAAWLGESGGE