Protein Info for LRK55_RS18430 in Rhodanobacter denitrificans MT42

Annotation: complement resistance protein TraT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05818: TraT" amino acids 30 to 243 (214 residues), 228.5 bits, see alignment E=4.2e-72

Best Hits

Swiss-Prot: 39% identical to TRAT3_ECOLX: TraT complement resistance protein (traT) from Escherichia coli

KEGG orthology group: None (inferred from 48% identity to tmz:Tmz1t_0792)

Predicted SEED Role

"IncF plasmid conjugative transfer surface exclusion protein TraT" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>LRK55_RS18430 complement resistance protein TraT (Rhodanobacter denitrificans MT42)
MKILGSIALLGALLTLGGCAATQVAISKHELVVQNKMSESVFLTPTADKTVYVDVRNTTD
KPNFTFDAQVKSAIERRGYRVVTNPDEAHFMLQANVLQVGQSSQTASQAGFGGGFGSPLD
GALTGMAAAAALNGNIGGRGIGAIGLAAGAADFIAGSMVKDVYFSAIVDIQISERTNSAV
HVNGEQHLAQGSSGDERVTYDETTNFKRYRTRILSSANKVNLKWEDAEPVIIAGLTQSVS
GIF