Protein Info for LRK55_RS18105 in Rhodanobacter denitrificans MT42

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 18 to 209 (192 residues), 243.1 bits, E=1.4e-76
• PF00117: GATase
  • amino acids 19 to 203 (185 residues), 143.8 bits, E=1.6e-45
• PF07722: Peptidase_C26
  • amino acids 83 to 188 (106 residues), 33.4 bits, E=1.3e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 217 to 534 (318 residues), 488.4 bits, E=9.2e-151
• PF02540: NAD_synthase
  • amino acids 223 to 300 (78 residues), 30.9 bits, E=4.7e-11
• PF03054: tRNA_Me_trans
  • amino acids 234 to 299 (66 residues), 21 bits, E=6.9e-08
• PF00958: GMP_synt_C
  • amino acids 442 to 533 (92 residues), 144.3 bits, E=3e-46

Best Hits

Swiss-Prot: 86% identical to GUAA_STRM5: GMP synthase [glutamine-hydrolyzing] (guaA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 86% identity to smt:Smal_1672)

MetaCyc: 67% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (534 amino acids)

>LRK55_RS18105 glutamine-hydrolyzing GMP synthase (Rhodanobacter denitrificans MT42)
MTESRTPNPQSRLHDDKILILDFGAQYTQLIARRVRELGVYCEIWAWDHDPAEIAAFGAK
GFILSGGPESTTLEGAPKAPPQVFDAGLPILGICYGMQTLAAQLGGATEAADAREFGHAS
VDIVAPSRLFDGLTDHPGEHKLDVWMSHGDHVSKAPPGFVVTGSTDRIPVAVMENDAKRW
YGVQFHPEVTHTKQGGALLKRFITGICGCATLWTAANIIGDQIERVRAQVGDDHVLLGLS
GGVDSSVVAALLHKAIGDRLTCVFVDTGLLRWQEGDQVMATMAEHMGVKVIRVDAADRYF
QALEGVTDPETKRKIIGGLFVEIFDEESSKITADGSKVKWLAQGTIYPDVIESAGSKTGK
AHVIKSHHNVGGLPAHMKLKLVEPLRELFKDEVRRIGVELGLPRAMVYRHPFPGPGLGVR
ILGEVKREYAELLAKADAIFIDELRKADLYDKTSQAFAVFLPVKSVGVVGDARAYEWVIA
LRAVETVDFMTAHWAHLPYEFLGKVSNRIINELRGVSRVVYDISGKPPATIEWE