Protein Info for LRK55_RS18070 in Rhodanobacter denitrificans MT42

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 11 to 248 (238 residues), 220.6 bits, see alignment E=1.1e-69 PF07719: TPR_2" amino acids 45 to 78 (34 residues), 23.7 bits, see alignment 2.5e-08 PF14559: TPR_19" amino acids 56 to 100 (45 residues), 26.3 bits, see alignment 5.3e-09 PF13181: TPR_8" amino acids 80 to 111 (32 residues), 14 bits, see alignment 3.4e-05 PF13432: TPR_16" amino acids 87 to 144 (58 residues), 17.5 bits, see alignment E=3.5e-06 amino acids 160 to 209 (50 residues), 21.6 bits, see alignment 1.8e-07 PF13374: TPR_10" amino acids 117 to 141 (25 residues), 19.6 bits, see alignment (E = 5e-07) PF13431: TPR_17" amino acids 172 to 203 (32 residues), 26.3 bits, see alignment 4.1e-09 PF13174: TPR_6" amino acids 218 to 250 (33 residues), 15.2 bits, see alignment 2e-05

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 40% identity to tgr:Tgr7_2050)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>LRK55_RS18070 type IV pilus biogenesis/stability protein PilW (Rhodanobacter denitrificans MT42)
MRFDRVVIFSLLLPLAGCITTHTDSSSLGKSMPQTSKAEQAEDAARIHTELGQRYMTNGD
LQTALEKLTKALQFDPNYAPAHTVIAVLYERINKLPEAEQHYRKAVALEPARGAPNNNLG
VFLCHTGKIAEAKQYFQKAVADPFYQTPDVALTNAGVCQLRADDASGAEASFRDAIARNP
KNAEALFQLANTLYLNKDAFRARAFLQRFDALGQPTAASLKLGHDIEIRLGNPEGARTYS
KRLLSQFPDSEQAHTLDTTASP