Protein Info for LRK55_RS17895 in Rhodanobacter denitrificans MT42

Annotation: integration host factor subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR00988: integration host factor, beta subunit" amino acids 1 to 92 (92 residues), 146.4 bits, see alignment E=1.2e-47 PF00216: Bac_DNA_binding" amino acids 1 to 91 (91 residues), 104.2 bits, see alignment E=3.5e-34 PF18291: HU-HIG" amino acids 10 to 92 (83 residues), 35.8 bits, see alignment E=7.7e-13

Best Hits

Swiss-Prot: 74% identical to IHFB_THISH: Integration host factor subunit beta (ihfB) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K05788, integration host factor subunit beta (inferred from 77% identity to tkm:TK90_1213)

Predicted SEED Role

"Integration host factor beta subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>LRK55_RS17895 integration host factor subunit beta (Rhodanobacter denitrificans MT42)
MTKSELIEALARRQTHLAFADVEMAVKSIIEQMSHALAHGERIEVRGFGSFALHYRPPRM
GRNPKTGEAVALPGKHVPHFKPGKELRERVNQDLEQKIA