Protein Info for LRK55_RS17755 in Rhodanobacter denitrificans MT42

Annotation: 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 20 to 110 (91 residues), 101.9 bits, E=9.1e-34

Best Hits

Swiss-Prot: 54% identical to PHS_XANOM: Putative pterin-4-alpha-carbinolamine dehydratase (XOO2920) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 55% identity to psu:Psesu_1707)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (2/3 steps found)
• tetrahydropteridine recycling (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (113 amino acids)

>LRK55_RS17755 4a-hydroxytetrahydrobiopterin dehydratase (Rhodanobacter denitrificans MT42)
MNANDLASRHCQPRKGKEHALDAAQVVELLQQLPDWQLRGDGMAIAKDFRFSDFHHTLGF
INAVGFMANQEDHHPDLEAGYGHCQVLWSTHDVGGLSLNDFICAARVDALLAR