Protein Info for LRK55_RS17620 in Rhodanobacter denitrificans MT42

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02719: Polysacc_synt_2
  • amino acids 5 to 174 (170 residues), 62.5 bits, E=1.5e-20
• PF05368: NmrA
  • amino acids 5 to 119 (115 residues), 26.6 bits, E=1.5e-09
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 5 to 325 (321 residues), 418.7 bits, E=6.5e-130
• PF01370: Epimerase
  • amino acids 5 to 253 (249 residues), 189.3 bits, E=3.2e-59
• PF04321: RmlD_sub_bind
  • amino acids 5 to 158 (154 residues), 59.5 bits, E=1.2e-19
• PF01073: 3Beta_HSD
  • amino acids 6 to 244 (239 residues), 56 bits, E=1.3e-18
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 308 (303 residues), 162.7 bits, E=6.6e-51
• PF13460: NAD_binding_10
  • amino acids 9 to 155 (147 residues), 42.6 bits, E=2.4e-14
• PF07993: NAD_binding_4
  • amino acids 66 to 180 (115 residues), 27 bits, E=9.5e-10

Best Hits

Swiss-Prot: 57% identical to EXOB_AZOBR: UDP-glucose 4-epimerase (exoB) from Azospirillum brasilense

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 68% identity to tgr:Tgr7_2340)

MetaCyc: 49% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Protein Sequence (335 amino acids)

>LRK55_RS17620 UDP-glucose 4-epimerase GalE (Rhodanobacter denitrificans MT42)
MNNSVLVTGGAGYIGSHVVQQLVARGERVVVIDNLSTGFRDAVRGAELVVGNVGDRALVA
RVLGRHRVDAVLHFAAHTVVPESLGDPLKYYGNNTCNTQSLLACCAEAGVERFIFSSTAA
VYGVTENGMADEDTPTRPINPYGASKLMSETMLRDLCATGAMRHVTLRYFNVAGCDPLGR
IGHSTPHSTLLIKVACEHAVGKRASVSVFGSDYDTPDGTGIRDYIHVEDLAAAHLQALDH
LRDGGESLTLNCGYGHGYSVREVIDAVQRADGHPLTVIELPRRAGDTPMLVAHSDRLKQR
LDWRPRYDDLDVIVGTALLWERKLARQPVTLADRA