Protein Info for LRK55_RS17490 in Rhodanobacter denitrificans MT42

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 173 to 190 (18 residues), see Phobius details PF05222: AlaDh_PNT_N" amino acids 4 to 136 (133 residues), 129.3 bits, see alignment E=3.7e-41 PF01262: AlaDh_PNT_C" amino acids 140 to 347 (208 residues), 222.4 bits, see alignment E=1.4e-69 PF02826: 2-Hacid_dh_C" amino acids 168 to 266 (99 residues), 25.8 bits, see alignment E=1.9e-09 PF01134: GIDA" amino acids 169 to 230 (62 residues), 22.2 bits, see alignment E=2.1e-08 PF03807: F420_oxidored" amino acids 169 to 266 (98 residues), 23 bits, see alignment E=3e-08 PF03446: NAD_binding_2" amino acids 170 to 265 (96 residues), 24.6 bits, see alignment E=7e-09

Best Hits

Swiss-Prot: 47% identical to DHA_BACSU: Alanine dehydrogenase (ald) from Bacillus subtilis (strain 168)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 59% identity to nhl:Nhal_3421)

MetaCyc: 47% identical to alanine dehydrogenase subunit (Klebsiella aerogenes)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>LRK55_RS17490 alanine dehydrogenase (Rhodanobacter denitrificans MT42)
MRIGIPCETKTMEGRVALIPAAAADLARRGHEVFIQSGAGLQSGFADAAYTREGVTVVAD
AAALYAAGELIVKVKEPIAGDLALLEKRHLLFCYLHLAAEPELTRRLLDIGLTAVAFESV
TENGVLPLLLPMSVIAGRIATQLGTTLLHRPQGGKGKLLGGMASTPRGKVVVLGAGAAGG
NAAALAAAAGANVVVFDKRHDRLAEMMALGPNVTALYAYESSVAEEVRDADIVVGAVLIP
SARAPHVVSEAMVRTMEPGSVLVDIAIDQGGCFETSKPTTWEKPTYDVHGIPHFCVTNMP
GAVPQTSSLAISAAILPYVQRLAAGNEWRQFAPLNSGINVDGGKLVHPALQGML