Protein Info for LRK55_RS16580 in Rhodanobacter denitrificans MT42

Annotation: protein phosphatase 2C domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13672: PP2C_2
  • amino acids 14 to 193 (180 residues), 42.1 bits, E=1.2e-14
• PF00481: PP2C
  • amino acids 23 to 126 (104 residues), 24.7 bits, E=2.6e-09

Best Hits

KEGG orthology group: K01090, protein phosphatase [EC: 3.1.3.16] (inferred from 58% identity to smt:Smal_0846)

Predicted SEED Role

"Protein serine/threonine phosphatase PrpC, regulation of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

KEGG Metabolic Maps

• T cell receptor signaling pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.16

Protein Sequence (233 amino acids)

>LRK55_RS16580 protein phosphatase 2C domain-containing protein (Rhodanobacter denitrificans MT42)
MIEFGHGTHVGLRRTRNEDTYYADASLGLFLVADGMGGHQHGEVASALVRDGVVELVGKG
HGLIEAVHAAAERLLAHTRPSFDVLPMGTTIAALRISGEGYEVAWVGDSRIYLWKKELRQ
ISHDHSLVQALVEAGQLDPAQVAQHPQRNVLTQALGVTAIEQLHVGMARGQLEPGMGFLL
CSDGLTEGVSDASIARVVARTDLAAQECVDQLLLSALDSGGDDNVTVLLVRSS