Protein Info for LRK55_RS16350 in Rhodanobacter denitrificans MT42

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 7 to 227 (221 residues), 215.5 bits, E=3.1e-68
• PF01128: IspD
  • amino acids 8 to 228 (221 residues), 207.6 bits, E=2.2e-65
• PF12804: NTP_transf_3
  • amino acids 8 to 128 (121 residues), 36.4 bits, E=6e-13

Best Hits

Swiss-Prot: 60% identical to ISPD_XANC5: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: None (inferred from 75% identity to rcu:RCOM_2020190)

MetaCyc: 45% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (232 amino acids)

>LRK55_RS16350 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Rhodanobacter denitrificans MT42)
MSAPALWCVVPAAGRGTRVGGDCPKQYLPLAGRPLIAHTLERLAVHPRIGGLLVTLAAGD
AHWSRIGTLSGKPVLTAVGGAERSDSVLAGIDALPASVGADDFVLVHDAARPCVRLADIG
RLIELAGAADGGLLGAPLRDTLKRADAAGRSVQTEPRDLRWRAFTPQMFRRGQLAAALRD
AARRGVNVSDEAMAMELAGCTPLLVEGAEDNIKVTTAADFALAEFLLARTVA