Protein Info for LRK55_RS16165 in Rhodanobacter denitrificans MT42

Annotation: metallophosphoesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF12850: Metallophos_2" amino acids 1 to 227 (227 residues), 30 bits, see alignment E=5e-11 PF00149: Metallophos" amino acids 19 to 212 (194 residues), 30.1 bits, see alignment E=6.7e-11

Best Hits

KEGG orthology group: None (inferred from 56% identity to ajs:Ajs_0506)

Predicted SEED Role

"Ser/Thr protein phosphatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>LRK55_RS16165 metallophosphoesterase family protein (Rhodanobacter denitrificans MT42)
MRLHILSDLHLSTHGMPSPEVAADLTILAGDIRRPAAEAMQWAAGLGRPVLYVPGNHEFY
GGAIPQVRQALARSAREHGIGLLDQGTCTIGGVRFVGTTLWTDFELFGAEGKDLAMTASA
QFMRDFAAIRNADGSVFTPADAAALFAEQYAWLAAVLEEPFAGSTVVITHHAPTPRSVHP
RFAASPVSAAFVSDCSALMGRAVLWVHGHTHDSFDYTANGTRVVCNPRGYSTGGVNENPQ
FDPCLCIEVATGA