Protein Info for LRK55_RS16145 in Rhodanobacter denitrificans MT42

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 331 to 364 (34 residues), see Phobius details amino acids 369 to 398 (30 residues), see Phobius details PF00654: Voltage_CLC" amino acids 84 to 397 (314 residues), 238.5 bits, see alignment E=6.2e-75

Best Hits

KEGG orthology group: None (inferred from 66% identity to oca:OCAR_6400)

Predicted SEED Role

"voltage-gated chloride channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>LRK55_RS16145 chloride channel protein (Rhodanobacter denitrificans MT42)
MPRLRLAEPLVMLATVVQWLVLSMLTGAVVGVGCSVFLHLLFATEGHVYAVPLGVQMSLL
VVGGFANGLLLHYGYRLSRSGYSDSPIVAVNEQRGRMPFRTLWVKPVAALITLGCGGSAG
KEGPCSHIGASLAAGIGRVLHLNPELRKRLLACGVSAGFASVFGTPIAGAIYGVEMLAIG
RIRHDFLFPGIVAGVTAFQVSKYLGVPYPHYHIAFISDFTELLFLKTVLIGILCGAAAWV
FVELLQQARRLFGRLRDRYVLWPPLVPLLGGVVLALLVMVVPSDYLGLSLPIMERALHGE
TMPYLGFLWKALLVAITLGSGFYGGIVTPQFVIGAVLGGAFAHLLGLAPALGAAVGLVAV
VASASNAPIAAILMGIELFGADSTLYVAGACVAAYLIIGHRSVYPAQQIAFSKSSWIFAH
TDLPVGQEKTRLSYGLLRWWSKRRRALQGPARPGAAKGEGDR