Protein Info for LRK55_RS16130 in Rhodanobacter denitrificans MT42

Annotation: cytochrome-c peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03150: CCP_MauG" amino acids 51 to 201 (151 residues), 188.1 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 58% identical to CCPR_PSEAE: Cytochrome c551 peroxidase (ccpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00428, cytochrome c peroxidase [EC: 1.11.1.5] (inferred from 63% identity to gsu:GSU2813)

MetaCyc: 58% identical to cytochrome c peroxidase (Pseudomonas aeruginosa)
Cytochrome-c peroxidase. [EC: 1.11.1.5]

Predicted SEED Role

"Cytochrome c551 peroxidase (EC 1.11.1.5)" (EC 1.11.1.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>LRK55_RS16130 cytochrome-c peroxidase (Rhodanobacter denitrificans MT42)
MPSIKLVSLMVLASLATGQAWSQTALMKQAQGLFKPIPANAPPLPGNAATPAKVELGKML
YFEPRLSESHAISCNSCHMVGMGGVDLQETSLGHRWQHGGRNAPTVYNAVFDVAQFWDGR
AKDLEQQAGGPLVNPVEMDTTEAHVVEQLKGIPGYAAVFAKAYPAVPDPITFDNVRKAIA
LFEATLITPNAPFDRYLQGNEKALDANQKEGLALFINKGCAACHNGINVGGGMYAPFGVV
ERPGADILPPGDKGRFAVTKTVSDEYVFRVPSLRNIALTAPYFHTGKVWDLRQAVAIMGS
SQLGAKLSDEEVGKIEVFLGALTGDQPKVALPILPPSVATTPRPKP