Protein Info for LRK55_RS15650 in Rhodanobacter denitrificans MT42

Annotation: PA4780 family RIO1-like protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01163: RIO1" amino acids 31 to 221 (191 residues), 136.5 bits, see alignment E=8.4e-44

Best Hits

KEGG orthology group: K07178, RIO kinase 1 [EC: 2.7.11.1] (inferred from 74% identity to psu:Psesu_2606)

Predicted SEED Role

"FIG01209899: hypothetical protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>LRK55_RS15650 PA4780 family RIO1-like protein kinase (Rhodanobacter denitrificans MT42)
MKTPKGLQDLIDEGVIDQVLRPLKSGKEASVYIVRSGEDVRCAKVYKDMAQRSFQARVQY
QEGRKVRGSRQARAMGKATKFGRKEAEAAWKNAEVDALYQLTAAGVRVPKPYGYFNGVLV
MELVTDMDGHSAPRLGEVELSADTARDYHRFLMQQVARMLCVGLIHGDLSEYNVLVGPHG
PVIIDLPQAVSASGNNNARMMLRRDVGNITISLSRFAPELLDTHYGEEMWALYELGELHP
DSELTGHFEFDESIADVDSVMQSIIDAREEAIIRQQGREAAARGD