Protein Info for LRK55_RS15645 in Rhodanobacter denitrificans MT42

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 4 to 323 (320 residues), 443.1 bits, E=3.1e-137
• PF00296: Bac_luciferase
  • amino acids 6 to 293 (288 residues), 133.6 bits, E=5.1e-43

Best Hits

Swiss-Prot: 56% identical to YHBW_ECOLI: Luciferase-like monooxygenase (yhbW) from Escherichia coli (strain K12)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 78% identity to xcb:XC_2545)

Predicted SEED Role

"Luciferase-like"

MetaCyc Pathways

• bacterial bioluminescence (1/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Protein Sequence (332 amino acids)

>LRK55_RS15645 LLM class flavin-dependent oxidoreductase (Rhodanobacter denitrificans MT42)
MIPFSILDLAPVIEGSDASQAFRNTLDLAQLAERLGYRRYWLAEHHNMPGIASAATAVLI
GHVAGGTSTIRVGAGGIMLPNHAPLQVAEAFGTLASLYPGRIDLGLGRAPGTDQPTAKAL
RRYFDSADAFPHDVLELLGYFEPAQPGQPVRAVPGAGIEVPVWLLGSSLFGAQLAARLGL
PYAFASHFAPDAMDEALALYRRDFRPSARLQQPYAMLGLNVVAAASDAEARRLFTTQQQS
FINLRRGRPGLIPPPIDDIESYWTPPEKLMVERALPCAVVGAADTVKDGIEAFVARHRPD
ELLLTANVFEHAARRQSFEIAAAVRDRLSAAN