Protein Info for LRK55_RS15505 in Rhodanobacter denitrificans MT42

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 312 to 337 (26 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 10 to 419 (410 residues), 202.1 bits, see alignment E=6.4e-64 TIGR00831: Na+/H+ antiporter" amino acids 11 to 544 (534 residues), 394.3 bits, see alignment E=4.1e-122

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 73% identity to azo:azo0346)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>LRK55_RS15505 Na+/H+ antiporter (Rhodanobacter denitrificans MT42)
MNSIEVALAMLLAVVGSGYLVRMLPFSLPLPLVQIGLGAVIAGVFKHGVALDPDIFFLLF
LPPLLFLDGWRIPKDGLLRDRGAILALALGLVVATVLGAGFLIHWLIPAMPLAVAFALAA
IVSPTDPVAVSSITARVPIPRRLMHILEGESLLNDATGLVCFRFAVAAAVTGGFSLLSAS
LTFLWVALVGLGVGVAFTVAVSFAQRWLSRHFGQEAGSPILISLLIPFGAYLLAEQVHAS
GILAAVAAGITMSYVELSGRLLATTRVQRTAVWNTVQFALNGIMFVLLGEQLPASLQGAV
ASVAQSGHRNPWWLLVYALAINVGLALLRLAWAWISLRLNVLKARHRGHPVSRLHWRLLL
ATSLAGVRGAITLAGVMTLPLLLPDGTPFPARELAIFLATAVILLSLLAASIGLPPLLKG
LELPPEPAVQREENLARRAAATAAIAAVEKTQHELLERAPASEVDTYTSAATRVIALYQH
WLDEDASGEDEARQLRKADAAERELRLAALQGQREAIFELARHYQISDEVSRRLVREIDL
QEARYR