Protein Info for LRK55_RS15245 in Rhodanobacter denitrificans MT42

Annotation: FAD-containing oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF07992: Pyr_redox_2" amino acids 6 to 317 (312 residues), 202.4 bits, see alignment E=2.7e-63 PF00070: Pyr_redox" amino acids 172 to 242 (71 residues), 52.8 bits, see alignment E=1.2e-17 PF02852: Pyr_redox_dim" amino acids 342 to 446 (105 residues), 85.4 bits, see alignment E=7.9e-28

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 65% identity to cak:Caul_4997)

Predicted SEED Role

"PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.16.1.1

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>LRK55_RS15245 FAD-containing oxidoreductase (Rhodanobacter denitrificans MT42)
MSRRFDAIIVGAGQAGPPLANRLTRAGRSVALVERKLFGGTCVNTGCMPTKTLVASARAA
HMARRAADFGVVLTGAVGIDMARVKARADTVIANARHGVRTWLDGMDGCTVIEGHAQFED
AHTLRVGDERLAAPQIFLNVGGRAAVPEMPGLRDVPYLTNTSILELDRVPAHLLIIGGSY
IGLEYAQMYRRFGARVIVVEKGPQLIGREDADVSTAVRGILEGEGIDIRTGVAELAFAGA
GETLAVTLDGERLACSHVLVAVGRVPNTGDLGLDQAGVATDARGYITVDDELRTNVPGIW
ALGDCNGRGAFTHTAYNDFEMVAANLLDGEHRKLSERVSGYALYIDPPLGRVGINEAQAR
QRGRPFLVGKRPMGRVGRAVERDETQGFMKVIIDADTKAILGAAILGIEGDEAIHGIIDM
MSVDATATQLQHTVPIHPTVSELLPTLIAEVHAPGG