Protein Info for LRK55_RS14910 in Rhodanobacter denitrificans MT42

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF00583: Acetyltransf_1" amino acids 55 to 140 (86 residues), 67.9 bits, see alignment E=2e-22 PF13508: Acetyltransf_7" amino acids 56 to 141 (86 residues), 54.9 bits, see alignment E=1.8e-18 PF13673: Acetyltransf_10" amino acids 60 to 145 (86 residues), 35.5 bits, see alignment E=1.8e-12 PF08445: FR47" amino acids 83 to 143 (61 residues), 29.5 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 46% identical to YHM7_SCHPO: Uncharacterized N-acetyltransferase C1271.07c (SPBC1271.07c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 52% identity to dia:Dtpsy_0284)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>LRK55_RS14910 GNAT family N-acetyltransferase (Rhodanobacter denitrificans MT42)
MPAPSTIDIAPARLPDDIELVRGLFAEYIAGLGVDLSFQDVGAELAQLPGKYAPPRGVIL
VARDDAGAVLGCVALRPRPQPGVCEIKRLYVRPVARGQALGRRLAEAVIAWAAEAGYARV
LLDTLASMQAARHLYAALGFRAVAPYYDNPVPGTLYMALELTAGAA