Protein Info for LRK55_RS14745 in Rhodanobacter denitrificans MT42
Annotation: phosphate regulon transcriptional regulator PhoB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to PHOB_ECOLI: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli (strain K12)
KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 78% identity to xac:XAC1042)Predicted SEED Role
"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (229 amino acids)
>LRK55_RS14745 phosphate regulon transcriptional regulator PhoB (Rhodanobacter denitrificans MT42) MHKRILIVEDETSIREMIAFALRKAGMDAIQAADARAAQLALAEQVPDLILLDWMLPGMS GLELARRLRKEELSREIPIIMLTARGEEMDRVNGLEAGVDDYVVKPFSTRELVARIKAVL RRSQGDDGSGVVELGGLRIDGPAHRVFAGDEPVPIGPTEYRLLYFFMTHPERVYSRTQLL DHVWGGSVYVEERTVDVHIRRLRKTLEPWKLDELVQTVRGTGYRFSTST