Protein Info for LRK55_RS14745 in Rhodanobacter denitrificans MT42

Annotation: phosphate regulon transcriptional regulator PhoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02154: phosphate regulon transcriptional regulatory protein PhoB
  • amino acids 1 to 226 (226 residues), 357 bits, E=1.6e-111
• PF00072: Response_reg
  • amino acids 5 to 117 (113 residues), 103.9 bits, E=5.6e-34
• PF00486: Trans_reg_C
  • amino acids 151 to 225 (75 residues), 94.4 bits, E=3.5e-31

Best Hits

Swiss-Prot: 63% identical to PHOB_ECOLI: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli (strain K12)

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 78% identity to xac:XAC1042)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Protein Sequence (229 amino acids)

>LRK55_RS14745 phosphate regulon transcriptional regulator PhoB (Rhodanobacter denitrificans MT42)
MHKRILIVEDETSIREMIAFALRKAGMDAIQAADARAAQLALAEQVPDLILLDWMLPGMS
GLELARRLRKEELSREIPIIMLTARGEEMDRVNGLEAGVDDYVVKPFSTRELVARIKAVL
RRSQGDDGSGVVELGGLRIDGPAHRVFAGDEPVPIGPTEYRLLYFFMTHPERVYSRTQLL
DHVWGGSVYVEERTVDVHIRRLRKTLEPWKLDELVQTVRGTGYRFSTST