Protein Info for LRK55_RS14625 in Rhodanobacter denitrificans MT42

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 218 to 259 (42 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 4 to 290 (287 residues), 95.2 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 47% identity to mxa:MXAN_0806)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>LRK55_RS14625 AEC family transporter (Rhodanobacter denitrificans MT42)
MLLLFVCLILGALVARYAKSPAGIVPGINWWVLNVALPALVLELIPKLKFDPQLWFPVAA
MWLTFGGAWLLFGLLGPRLGWSRQRTGALILVCGLGNTAYMGYPMIEALHGKAGLALAVV
ADQIGAFPVLASAGIVVASVYSGRTLQLRLIVRRIVTFPAFIALVVGIVAGLCGGWPALL
DGVFAPIGATLTPLALFSVGLQFKFHPGQRQLGAAGWGLGWKLLLAPLLCWALGTAAGVD
GLVLTVGVLQAAMAPMVSATILADEYGLEPALANTVLGAGIVLSLLTVPLGNRLLGG