Protein Info for LRK55_RS14440 in Rhodanobacter denitrificans MT42

Annotation: MetQ/NlpA family ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03180: Lipoprotein_9
  • amino acids 29 to 264 (236 residues), 332.3 bits, E=6.7e-104

Best Hits

Swiss-Prot: 42% identical to PLPB_MANHA: Outer membrane lipoprotein 2 (plpB) from Mannheimia haemolytica

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 69% identity to xca:xccb100_3813)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Protein Sequence (264 amino acids)

>LRK55_RS14440 MetQ/NlpA family ABC transporter substrate-binding protein (Rhodanobacter denitrificans MT42)
MKLLLASLTLTLLLLAGCSGSGKQGGNVLTVAATAVPHAEILKQAKPLLAKEGVELQVKV
FADYVQPNTQVAEKNIDLNYFQTKPYLDAFNRERGTRLTIVTGVHIEPFGAYSRKFKSID
QLPDGASVTLPNDPSNSGRALLLLAKHGLITLKDPTDEMATLKDVTANPKHLKFRELEAA
MLPRTLDEVDLALINTNYALAAGLNPTKDALLIEGKDSPYVNYLVGRPDNQDDPRVQKLA
RVLNSPQIKAFIEQKYHGAVLPAF