Protein Info for LRK55_RS14400 in Rhodanobacter denitrificans MT42

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 2 to 57 (56 residues), 29.4 bits, E=2.5e-10
• PF03446: NAD_binding_2
  • amino acids 2 to 155 (154 residues), 134.3 bits, E=1.1e-42
• PF02826: 2-Hacid_dh_C
  • amino acids 2 to 121 (120 residues), 28.8 bits, E=1.9e-10
• PF02558: ApbA
  • amino acids 4 to 48 (45 residues), 22.3 bits, 2.3e-08
• PF14833: NAD_binding_11
  • amino acids 165 to 281 (117 residues), 59.8 bits, E=8.1e-20

Best Hits

Swiss-Prot: 40% identical to YFJR_BACSU: Uncharacterized oxidoreductase YfjR (yfjR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 63% identity to csa:Csal_0960)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

• glycolate and glyoxylate degradation I (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• D-glucarate degradation I (1/4 steps found)
• D-galactarate degradation I (1/4 steps found)
• superpathway of D-glucarate and D-galactarate degradation (1/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (5/31 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.60

Protein Sequence (294 amino acids)

>LRK55_RS14400 NAD(P)-dependent oxidoreductase (Rhodanobacter denitrificans MT42)
MKVGFIGLGAMGSAMASNLLAAGHTLTVWNRSATASEPLASLGAKVAKTADRAAQGAALC
SMLANDRAVREVFLDGGLLDAMDRGTVHVNHATISVALARELAAEHEKRGLEYVAAPVFG
RPDMAAAAKLNILVAGKPAAIERVRPLLEAMGSKLWPLGEAPERANVAKIAGNFMLAAAI
ESMAEATALTRAHGVSAADFLDVMTNTLFAAPAYQGYGRLIAEQRFKPAGFALPLGYKDV
GLALAAGEAQRVPLPFAGVLRDAMLEALAAGDAELDWSALALVAARRAHLDERE