Protein Info for LRK55_RS14350 in Rhodanobacter denitrificans MT42

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 38 to 63 (26 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 123 to 139 (17 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details PF01810: LysE" amino acids 14 to 197 (184 residues), 63.9 bits, see alignment E=7.4e-22

Best Hits

KEGG orthology group: None (inferred from 31% identity to ppw:PputW619_2451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>LRK55_RS14350 LysE family translocator (Rhodanobacter denitrificans MT42)
MDPLLAACGLLCVAAITPGPNNLVVLRAAGQAGLRGAMPAIAGIVCGGLLLLAVMALGAG
AAFATHPPLRRWTGVIGAVYLAWLGVSLCAAGIAPRHAAATSAALPAGILGLIGFQFLNP
KSWVIVLSVLAAVPAAGLRDYLPLAGLFVLIPTLCLLLWAALGAWLARWLVRPTIRRGVD
IVMGALLVACAFLLLIEP