Protein Info for LRK55_RS14215 in Rhodanobacter denitrificans MT42

Annotation: GldG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 609 to 628 (20 residues), see Phobius details PF09822: ABC_transp_aux" amino acids 48 to 327 (280 residues), 205 bits, see alignment E=7.8e-65

Best Hits

Predicted SEED Role

"gliding motility protein GldG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (638 amino acids)

>LRK55_RS14215 GldG family protein (Rhodanobacter denitrificans MT42)
MPRSRLHRLFTTPLQPTRRGALYAALVLLVLLFVPLIVASSRGLHASRIDLTTDKLYTLT
PGTLHIVDTLQRPLRLTLYFSEHATRDLPQLRSYEQRVREMLQEMVARSHGRIRLQIIDP
VPYSDDEASAEGNGLTAANGGSNGERVFFGLAGSTLSGGPESEGADDRVPEKTLAIAFFD
PAREAFLEYDIAKLLYELNQASKPPIGVISSLPVQGNPVLGEQPWAVLQQLGQLFDVKPL
DASTLQKVDDGIRVLLLIHPKRLPVDAQYAIDQYVLRGGHLVVFVDPDAELDASPYGPDS
ITFPDHGSDLPRLFKAWGVSYDPHKVVLDRARALQIELAGSSLNHPAMLDLGAQELNRND
VVTASLQRINVSTTGYFDLAADARTRLVPLLQSSAEAEVVPTQRVLDASSDPTALLQDYR
PDNAHYVLAARLRGTFDSAFPERAGVAGHRARSAPDAEVILVADTDLLSDRLWVEPQTIL
GQTMMRVFANNGDFVTNLVDNLSGSSALLSIRGCSTSQRPFTRVQALRNVADQKFLQKEH
ELEQELADTRRRLDELQPAKGSHGSAASAEQRREIEQFRQRQLAINKELRDVQHQLNAEI
DALGLRLKFINIVLVPALVVLLGLLYGWRRTRYSRRRR