Protein Info for LRK55_RS14120 in Rhodanobacter denitrificans MT42

Annotation: cyclopropane fatty acyl phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF02353: CMAS" amino acids 99 to 357 (259 residues), 278.1 bits, see alignment E=2.7e-86 PF13489: Methyltransf_23" amino acids 153 to 261 (109 residues), 42.9 bits, see alignment E=1.6e-14 PF07021: MetW" amino acids 154 to 191 (38 residues), 21.5 bits, see alignment 5.7e-08 PF13847: Methyltransf_31" amino acids 155 to 252 (98 residues), 29.6 bits, see alignment E=1.9e-10 PF13649: Methyltransf_25" amino acids 160 to 250 (91 residues), 58.1 bits, see alignment E=4.2e-19 PF08241: Methyltransf_11" amino acids 161 to 252 (92 residues), 49 bits, see alignment E=2.8e-16 PF08242: Methyltransf_12" amino acids 161 to 251 (91 residues), 42.3 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 66% identity to sml:Smlt3231)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>LRK55_RS14120 cyclopropane fatty acyl phospholipid synthase (Rhodanobacter denitrificans MT42)
MSQDDLKNRASDLLEQAGIRIDGDAPTDLRVHDERLYARVFAHGSLGLGEAYMDGWWDAD
DLPALCTRLLTAGLDQELKTLDTLLAHLKARFVNLQRGERAFEIGKAHYDLGNDLFHAML
GKRLVYSCGYWAKADNLDDAQAAKLDLVCRKLQLKTGQRVLDIGCGWGEALKYAAERYGV
EGVGITVSQQQADYARELCAGLPIEIRLQDYHEVNERFDAVFSIGMFEHVGGRNYRAYFE
TVRRCLKNEGLSLLHCIGSNGAPAQPDPWIEKYIFPNSMIPAASQVAAALEDLFVVEDWH
NFGTDYDRTLTAWRANVEAAWPSLPASYDERFRRMWRYYLAVSAAVFRSRRDQLWQLTLS
PRGVPGGYRVPR