Protein Info for LRK55_RS14065 in Rhodanobacter denitrificans MT42

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 191 (185 residues), 169.1 bits, E=1.7e-53
• PF08659: KR
  • amino acids 8 to 175 (168 residues), 56.7 bits, E=6.1e-19
• PF13561: adh_short_C2
  • amino acids 15 to 241 (227 residues), 189.6 bits, E=1.4e-59

Best Hits

Swiss-Prot: 37% identical to LINC_SPHJU: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linC) from Sphingobium japonicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2766)

MetaCyc: 30% identical to pyridoxal 4-dehydrogenase subunit (Mesorhizobium loti)
Pyridoxal 4-dehydrogenase. [EC: 1.1.1.107]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• vitamin B₆ degradation I (1/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.107 or 1.1.1.36

Protein Sequence (244 amino acids)

>LRK55_RS14065 SDR family oxidoreductase (Rhodanobacter denitrificans MT42)
MTRLNGKTAVITGGATGIGRAAAKRFIDEGAFVFIFGRRQEALDAAVADLGPNARAVQGS
VSDEADLDRLYAAVKAERGTLDIVFANAGTGSLLALGEITAEHIDETFDTNVKGTIFTVQ
KALPLMGTDGSIILTGSSAGTTGAPAFGAYSASKAAVRNLAKTWAEDLKGTGIRVNVLSP
GPTATELAKAAVGEEGLNAFASMNPLQRMADPAEIGAVAAFLASSDSSFMTASEVAVDGG
LAQI