Protein Info for LRK55_RS13550 in Rhodanobacter denitrificans MT42

Annotation: YhgN family NAAT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details PF01914: MarC" amino acids 5 to 193 (189 residues), 167.9 bits, see alignment E=9.9e-54

Best Hits

Swiss-Prot: 53% identical to YHGN_SHIFL: UPF0056 inner membrane protein YhgN (yhgN) from Shigella flexneri

KEGG orthology group: None (inferred from 66% identity to plm:Plim_2864)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>LRK55_RS13550 YhgN family NAAT transporter (Rhodanobacter denitrificans MT42)
MTTLSAGILLFLIMDPLGNIPLFLSLLKDVPPKRRRRVMVRELLIALGVLLAFLFGGQYF
LRLLQLKQESISIAGGIVLFLIGIRMVFPPADGSGIFGKAGGGEPFIVPMAIPGVAGPSA
MAALLLLTNTQPGRTADWTIALLLAWLASSLILLSATYLFRWLGESVLTALERVMGMLLI
ALSVQMFMAGVASFLHMNV