Protein Info for LRK55_RS13340 in Rhodanobacter denitrificans MT42

Annotation: flagellar motor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details PF20560: MotA_N" amino acids 6 to 78 (73 residues), 32.1 bits, see alignment E=1.1e-11 PF01618: MotA_ExbB" amino acids 102 to 219 (118 residues), 105.7 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 31% identical to MOTA_BORBU: Motility protein A (motA) from Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 62% identity to tgr:Tgr7_1343)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>LRK55_RS13340 flagellar motor protein (Rhodanobacter denitrificans MT42)
MDLVSIIGTILAFVVIILGTVLKGSTVGALWNAAAFVIVFAGTAAALLVQTQGKVLKHAF
RMLSMVYRPPQHQPGDLISRIVGWSEISRRQGLLGLEPQIEAEPDPFVSKGLQLLVDGGE
PEAIRSVLEVDLETREAIDLAGAKVYEMAGIYSPTLGIIGAVMGLMAVMQNLADPSKLGH
GIAAAFVATIYGVALANLFMLPMAARLKGLISKQTQMREILIEGLVSIAQGDNPRQIEAR
LQGYVA